PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10018380m
Common NameEUTSA_v10018381mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family TALE
Protein Properties Length: 536aa    MW: 60407.7 Da    PI: 6.7033
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10018380mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.84.8e-103824191954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  Thhalv10018380m 382 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 419
                      665559******************************88 PP

2BELL123.11.1e-39245316172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      erqelq+kk+kLl++++eVdk+Y+qy++q+++++ssFe+vaglg+akpYts+Al++iSrhFrcL+dai+eqi
  Thhalv10018380m 245 ERQELQSKKNKLLTMVDEVDKKYNQYYHQMEALASSFEMVAGLGAAKPYTSVALNRISRHFRCLRDAIKEQI 316
                      79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.6E-52177314IPR006563POX domain
PfamPF075261.5E-47183312IPR006563POX domain
PROSITE profilePS5007112.422360423IPR001356Homeobox domain
CDDcd000861.34E-11363424No hitNo description
SMARTSM003896.5E-10363427IPR001356Homeobox domain
SuperFamilySSF466898.55E-18364431IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-28366429IPR009057Homeodomain-like
PfamPF059206.7E-18380419IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MAVYYPTSVG MQSLYQESIY LNEQQQQQQQ QQASSSSAAS LSEIVSGGGG GGGGNCLDIP  60
NSGGVRNEMV FIPPTSDDVV VTGLNGNVNG NVTVSSNDLS FHGGGLSLSL GNQIQYHYQN  120
LSNQLNYNNQ NPSLSDENGK TLSHHHHHHH TQSEQQIPFS GYNNGVGFYN NYRYETSGFV  180
SSVLRSRYLK PTQQLLDEVV SVRKDLKLGS SNKKTKNDKG QDFTSGSSDN NTANEKLQQE  240
LSPSERQELQ SKKNKLLTMV DEVDKKYNQY YHQMEALASS FEMVAGLGAA KPYTSVALNR  300
ISRHFRCLRD AIKEQIQVIR GKLGERETSD EQGERIPRLR YLDQRLRQQR ALHQQLGMVR  360
PAWRPQRGLP ENSVSILRAW LFEHFLHPYP KESEKIMLAK QTGLSKNQVA NWFINARVRL  420
WKPMIEEMYK EEFGDSSELP INSNQDNKMQ ETTQPKHEDA SSQQQTQGNN NIAYTSDAEE  480
NLVFADPKPD RAAGDYDSLM NYHGFGIDDY NRYIGLGNQQ DGRFSNPHQL HDFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16369427563Homeobox protein Meis2
3k2a_B4e-16369427563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3530930.0AF353093.1 Arabidopsis thaliana BEL1-like homeodomain 3 (BLH3) mRNA, complete cds.
GenBankAY0625450.0AY062545.1 Arabidopsis thaliana Similar to homeodomain proteins (At1g75410; F1B16.6) mRNA, complete cds.
GenBankAY0852780.0AY085278.1 Arabidopsis thaliana clone 142443 mRNA, complete sequence.
GenBankAY5984520.0AY598452.1 Arabidopsis thaliana BEL1-like homeodomain 3 protein mRNA, complete cds.
GenBankBT0001330.0BT000133.1 Arabidopsis thaliana Similar to homeodomain proteins (At1g75410) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390306.10.0hypothetical protein EUTSA_v10018381mg
RefseqXP_006390307.10.0hypothetical protein EUTSA_v10018381mg
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLV4KK100.0V4KK10_EUTSA; Uncharacterized protein
STRINGAT1G75410.10.0(Arabidopsis thaliana)
STRINGfgenesh2_kg.2__1821__AT1G75410.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3